Pfam domain
Pfam family: MutS_I (PF01624.22)
Uniprot AC: P20585
RecName: DNA mismatch repair protein Msh3
Begin-End: 230-343
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
TPLELQYIEMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHR
LFVHVRRLVAKGYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGED
Structures of the domain P20585 230-343
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3thz X-ray 4.3 B 221-334  S-Bb L-Bb L-Mn 
3thw X-ray 3.09 B 221-334  H-Bb S-Bb L-Bb L-Mj L-Mn 
3thx X-ray 2.7 B 221-334  H-Bb S-Bb L-Bb L-Mj L-Mn 
3thy X-ray 2.89 B 221-334  H-Bb S-Bb S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text