Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: P20831
RecName: DNA gyrase subunit A
Begin-End: 33-474
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb L-Mn 

Sequence:
RALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVR
MAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDG
NEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMED
IEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKAR
MIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFG
VNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHID
EIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYI
SELEAILADEEVLLQLVRDELT
Structures of the domain P20831 33-474
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5bs3 X-ray 2.65 B 1033-1474 None
5bs3 X-ray 2.65 D 1033-1474 None
4plb X-ray 2.69 D 1033-1474  H-Bb S-Bb S-Mj S-Mn L-Bb 
4plb X-ray 2.69 B 1033-1474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6z1a X-ray 2.3 D 1033-1474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
6z1a X-ray 2.3 B 1033-1474  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text