Pfam domain
Pfam family: Zn_clus (PF00172.20)
Uniprot AC: P21228
RecName: Regulatory protein alcR
Begin-End: 10-59
Organism: Emericella nidulans
Interaction Mode:   

Sequence:
HSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRWNKDCTFNWLSSQRS
Structures of the domain P21228 10-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1f4s NMR P 10-59  H-Bb H-Mj L-Bb L-Mj 
1f5e NMR P 10-59  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text