Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: P21466
RecName: 30S ribosomal protein S4
Begin-End: 92-139
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
SRLDNVVYKLGLARTRRQARQLVNHGHILVDGSRVDIPSYLVKPGQTI
Structures of the domain P21466 92-139
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 A 51-98 None


© NPIDB team 2003 - 2021

text