Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: P21513
RecName: Ribonuclease E
Begin-End: 35-119
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVL
REGQEVIVQIDKEERGNKGAALTTF
Structures of the domain P21513 35-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vrt X-ray 3.5 D 35-119 None
2vrt X-ray 3.5 A 35-119 None
2bx2 X-ray 2.85 L 35-119 None
2c4r X-ray 3.6 L 35-119 None
2c0b X-ray 3.18 L 35-119 None
5f6c X-ray 3 B 35-119 None
5f6c X-ray 3 A 35-119 None
6g63 X-ray 3.95 N 35-119 None
6g63 X-ray 3.95 A 35-119 None
6g63 X-ray 3.95 L 35-119 None
6g63 X-ray 3.95 G 35-119 None


© NPIDB team 2003 - 2021

text