Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.21)
Uniprot AC: P21951
RecName: DNA polymerase epsilon catalytic subunit A
Begin-End: 121-442
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb 

Sequence:
FLDEEGGSFKSTVVYDPYFFIACNDESRVNDVEELVKKYLESCLKSLQIIRKEDLTMDNH
LLGLQKTLIKLSFVNSNQLFEARKLLRPILQDNANNNVQRNIYNVAANGSEKVDAKHLIE
DIREYDVPYHVRVSIDKDIRVGKWYKVTQQGFIEDTRKIAFADPVVMAFDIETTKPPLKF
PDSAVDQIMMISYMIDGEGFLITNREIISEDIEDFEYTPKPEYPGFFTIFNENDEVALLQ
RFFEHIRDVRPTVISTFNGDFFDWPFIHNRSKIHGLDMFDEIGFAPDAEGEYKSSYCSHM
DCFRWVKRDSYLPQGSQGLKAV
Structures of the domain P21951 121-442
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ptf X-ray 2.81 A 121-442  H-Bb 
6h1v X-ray 2.7 A 121-442  H-Bb 
4m8o X-ray 2.2 A 121-442  H-Bb 
6i8a X-ray 2.65 A 121-442  H-Bb 
6i8a X-ray 2.65 B 121-442  H-Bb 
6g0a X-ray 2.62 A 121-442  H-Bb 
6qib X-ray 2.8 A 121-442  H-Bb 
6fwk X-ray 2.5 A 121-442  H-Bb 
6fwk X-ray 2.5 B 121-442  H-Bb 


© NPIDB team 2003 - 2021

text