Pfam domain
Pfam family: HSA (PF07529.15)
Uniprot AC: P22082
RecName: Transcription regulatory protein SNF2
Begin-End: 591-660
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LLKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEK
KAKERLQALK
Structures of the domain P22082 591-660
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6uxw X-ray 8.96 A 133-660 None


© NPIDB team 2003 - 2021

text