Pfam domain
Pfam family: HSF_DNA-bind (PF00447.19)
Uniprot AC: P22121
RecName: Heat shock factor protein
Begin-End: 197-284
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
FVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYG
WHKVQDVKSGSMLSNNDSRWEFENENFK
Structures of the domain P22121 197-284
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3hts X-ray 1.75 B 197-282 None
1fyl X-ray 2.1 A 197-284 None
1fyl X-ray 2.1 B 197-280 None


© NPIDB team 2003 - 2021

text