Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.22)
Uniprot AC: P22138
RecName: DNA-directed RNA polymerase I subunit RPA135
Begin-End: 1067-1201
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTV
CCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLD
SELSAMGIRLRYNVE
Structures of the domain P22138 1067-1201
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m5x X-ray 4 B 1067-1201 None
6tps X-ray 3.54 B 1067-1201 None
5m64 X-ray 4.6 B 1067-1201 None
6ruo X-ray 3.5 B 1067-1201 None
6rrd X-ray 3.1 B 1067-1201 None
6rql X-ray 2.9 B 1067-1201 None
5n61 X-ray 3.4 B 1067-1201 None
5m5w X-ray 3.8 B 1067-1201 None
5m5y X-ray 4 B 1067-1201 None
5m3f X-ray 3.8 B 1067-1201 None
6h67 X-ray 3.6 B 1067-1201 None
5oa1 X-ray 4.4 B 1067-1201 None
6hko X-ray 3.42 B 1067-1201 None
6rqt X-ray 4 B 1067-1201 None
6h68 X-ray 4.6 B 1067-1201 None
6rqh X-ray 3.7 B 1067-1201 None
6rwe X-ray 3 B 1067-1201 None
6hlq X-ray 3.18 B 1067-1201 None
6rui X-ray 2.7 B 1067-1201 None
6hlr X-ray 3.18 B 1067-1201 None


© NPIDB team 2003 - 2021

text