Pfam domain
Pfam family: zf-C4 (PF00105.20)
Uniprot AC: P22736
RecName: Nuclear receptor subfamily 4 group A member 1
Begin-End: 266-334
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQ
KCLAVGMVK
Structures of the domain P22736 266-334
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6lc1 X-ray 3.12 A 266-334  H-Bb H-Mj S-Bb S-Mj L-Bb 
6lc1 X-ray 3.12 D 265-334  H-Bb H-Mj S-Bb S-Mj L-Bb 
6lc1 X-ray 3.12 G 266-334  H-Bb H-Mj S-Bb S-Mj L-Bb 
6lc1 X-ray 3.12 J 265-334  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text