Pfam domain
Pfam family: MotCF (PF09158.12)
Uniprot AC: P22915
RecName: Middle transcription regulatory protein motA
Begin-End: 106-208
Organism: Enterobacteria phage T4
Interaction Mode:  S-Bb S-Mj L-Bb L-Mj 

Sequence:
ITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGY
KMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVA
Structures of the domain P22915 106-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6k4y X-ray 3.79 M 106-208  S-Bb S-Mj L-Bb L-Mj 
5jlt X-ray 2.96 B 106-208  S-Bb S-Mj L-Bb L-Mj 
5jlt X-ray 2.96 C 106-208  S-Bb S-Mj L-Bb L-Mj 
5jlt X-ray 2.96 A 106-208  S-Bb S-Mj L-Bb L-Mj 
5jlt X-ray 2.96 D 106-208  S-Bb S-Mj 
5jlt X-ray 2.96 A 106-208  S-Bb S-Mj L-Bb L-Mj 
5jlt X-ray 2.96 C 106-208  S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text