Pfam domain
Pfam family: MotA_activ (PF09114.12)
Uniprot AC: P22915
RecName: Middle transcription regulatory protein motA
Begin-End: 3-96
Organism: Enterobacteria phage T4
Interaction Mode:   

Sequence:
KVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLV
EKSGDGLIITGEAQDIISNAATLYAQENAPELLK
Structures of the domain P22915 3-96
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6k4y X-ray 3.79 M 3-96 None


© NPIDB team 2003 - 2021

text