Pfam domain
Pfam family: PDDEXK_1 (PF12705.9)
Uniprot AC: P23477
RecName: ATP-dependent helicase/deoxyribonuclease subunit B
Begin-End: 789-1131
Organism: Bacillus subtilis
Interaction Mode:  L-Bb 

Sequence:
QGSVSRMETFNACPFSHFASHGLHLKERQFFKLEAPDIGQLFHSSLKLISDRLREQKLDW
RDLTKEQCELFSYDAVERLAPKLQKEILLSSNRHYYVKEKLQKIVTRVSGILSEHAKASG
FVPIGLELGFGGKGPLPPLTFQLKNGCTMELVGRIDRVDKAESSKGLLLRIVDYKSSDKG
LDLAEVYYGLALQMLTYLDLSITHSADWLGMRATPAGVLYFHIHDPMIQSNLPLGLDEIE
QEIFKKFKMKGLLLGDQEVVRLMDTTLQEGRSNIINAGLKKDGSLRSDSAAVGEKEFDLL
TKHVRRTFQEAGEQITDGRVSIEPYKMKNKTPCTYCAFKSVCQ
Structures of the domain P23477 789-1131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3u4q X-ray 2.8 B 790-1131  L-Bb 
3u44 X-ray 3.2 B 790-1131  S-Bb S-Mn L-Bb 
4cej X-ray 3 B 790-1131  L-Bb 
4ceh X-ray 3.24 B 790-1131  L-Bb 
4cei X-ray 2.8 B 790-1131  L-Bb 


© NPIDB team 2003 - 2021

text