Pfam domain
Pfam family: UvrD-helicase (PF00580.23)
Uniprot AC: P23478
RecName: ATP-dependent helicase/nuclease subunit A
Begin-End: 11-462
Organism: Bacillus subtilis
Interaction Mode:  H-Bb L-Bb L-Mn 

Sequence:
WTDDQWNAIVSTGQDILVAAAAGSGKTAVLVERMIRKITAEENPIDVDRLLVVTFTNASA
AEMKHRIAEALEKELVQRPGSLHIRRQLSLLNRASISTLHSFCLQVLKKYYYLIDLDPGF
RIADQTEGELIGDEVLDELFEDEYAKGEKAFFELVDRYTTDRHDLDLQFLVKQVYEYSRS
HPNPEAWLESFVHLYDVSEKSAIEELPFYQYVKEDIAMVLNGAKEKLLRALELTKAPGGP
APRADNFLDDLAQIDELIQHQDDFSELYKRVPAVSFKRAKAVKGDEFDPALLDEATDLRN
GAKKLLEKLKTDYFTRSPEQHLKSLAEMKPVIETLVQLVISYGKRFEAAKQEKSIIDFSD
LEHYCLAILTAENDKGEREPSEAARFYQEQFHEVLVDEYQDTNLVQESILQLVTSGPEET
GNLFMVGDVKQSIYRFRLAEPLLFLSKYKRFT
Structures of the domain P23478 11-462
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3u4q X-ray 2.8 A 11-461 None
3u44 X-ray 3.2 A 11-461  H-Bb 
4cej X-ray 3 A 11-461  H-Bb L-Bb L-Mn 
4ceh X-ray 3.24 A 11-461  H-Bb L-Bb L-Mn 
4cei X-ray 2.8 A 11-461  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text