Pfam domain
Pfam family: UvrD_C (PF13361.8)
Uniprot AC: P23478
RecName: ATP-dependent helicase/nuclease subunit A
Begin-End: 472-885
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
IDLNKNFRSRADILDSTNFLFKQLMGGKIGEVDYDEQAELKLGAAYPDNDETETELLLID
NAEDTDASEEAEELETVQFEAKAIAKEIRKLISSPFKVYDGKKKTHRNIQYRDIVILLRS
MPWAPQIMEELRAQGIPVYANLTSGYFEAVEVAVALSVLKVIDNPYQDIPLASVLRSPIV
GADENELSLIRLENKKAPYYEAMKDYLAAGDRSDELYQKLNTFYGHLQKWRAFSKNHSVS
ELIWEVYRDTKYMDYVGGMPGGKQRQANLRVLYDRARQYESTAFRGLFRFLRFIERMQER
GDDLGTARALSEQEDVVRLMTIHSSKGLEFPVVFVAGLGRNFNMMDLNKSYLLDKELGFG
TKYIHPQLRISYPTLPLIAMKKKMRRELLSEELRVLYVALTRAKEKLFLIGSCK
Structures of the domain P23478 472-885
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3u4q X-ray 2.8 A 472-882 None
3u44 X-ray 3.2 A 472-882  L-Mn 
4cej X-ray 3 A 472-882  H-Bb 
4ceh X-ray 3.24 A 472-882 None
4cei X-ray 2.8 A 472-882 None


© NPIDB team 2003 - 2021

text