Pfam domain
Pfam family: MutS_III (PF05192.20)
Uniprot AC: P23909
RecName: DNA mismatch repair protein MutS
Begin-End: 272-559
Organism: Escherichia coli
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
ATRRNLEITQNLAGGAENTLASVLDCTVTPMGSRMLKRWLHMPVRDTRVLLERQQTIGAL
QDFTAGLQPVLRQVGDLERILARLALRTARPRDLARMRHAFQQLPELRAQLETVDSAPVQ
ALREKMGEFAELRDLLERAIIDTPPVLVRDGGVIASGYNEELDEWRALADGATDYLERLE
VRERERTGLDTLKVGFNAVHGYYIQISRGQSHLAPINYMRRQTLKNAERYIIPELKEYED
KVLTSKGKALALEKQLYEELFDLLLPHLEALQQSASALAELDVLVNLA
Structures of the domain P23909 272-559
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wtu X-ray 3.4 B 272-559  S-Bb L-Bb 
2wtu X-ray 3.4 A 272-559  S-Bb L-Bb 
1wb9 X-ray 2.1 A 272-559  S-Bb L-Bb 
1wb9 X-ray 2.1 B 272-559  H-Bb S-Bb L-Bb 
1wbd X-ray 2.4 B 272-559  S-Bb L-Bb 
1wbd X-ray 2.4 A 272-559  S-Bb L-Bb 
1ng9 X-ray 2.6 B 272-559  S-Bb L-Bb 
1ng9 X-ray 2.6 A 272-559  S-Bb L-Bb 
3k0s X-ray 2.2 B 272-559  H-Bb S-Bb L-Bb 
3k0s X-ray 2.2 A 272-559  S-Bb L-Bb 
1w7a X-ray 2.27 B 272-559  S-Bb L-Bb 
1w7a X-ray 2.27 A 272-559  S-Bb L-Bb 
1wbb X-ray 2.5 B 272-559  S-Bb L-Bb 
1wbb X-ray 2.5 A 272-559  S-Bb L-Bb 
1oh6 X-ray 2.4 A 272-559  S-Bb L-Bb 
1oh6 X-ray 2.4 B 272-559  S-Bb L-Bb 
3zlj X-ray 3.1 B 272-559  S-Bb L-Bb 
3zlj X-ray 3.1 A 272-559  S-Bb L-Bb 
1e3m X-ray 2.2 B 272-559  S-Bb L-Bb 
1e3m X-ray 2.2 A 272-559  S-Bb L-Bb 
1oh5 X-ray 2.9 B 272-559  S-Bb L-Bb 
1oh5 X-ray 2.9 A 272-559  S-Bb L-Bb 
1oh7 X-ray 2.5 B 272-559  S-Bb L-Bb 
1oh7 X-ray 2.5 A 272-559  S-Bb L-Bb 
1oh8 X-ray 2.9 B 272-559  L-Bb 
1oh8 X-ray 2.9 A 272-559  S-Bb L-Bb 


© NPIDB team 2003 - 2021

text