Pfam domain
Pfam family: MutS_I (PF01624.22)
Uniprot AC: P23909
RecName: DNA mismatch repair protein MutS
Begin-End: 36-123
Organism: Escherichia coli
Interaction Mode:   

Sequence:
FYELFYDDAKRASQLLDISLTKRGASAGEPIPMAGIPYHAVENYLAKLVNQGESVAICEQ
IGDPATSKGPVERKVVRIVTPGTISDEA
Structures of the domain P23909 36-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wtu X-ray 3.4 B 36-123 None


© NPIDB team 2003 - 2021

text