Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: P24279
RecName: DNA replication licensing factor MCM3
Begin-End: 166-302
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRI
PTPAIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDK
TKPGDRVNVVGVFKSLG
Structures of the domain P24279 166-302
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 B 166-302 None
6f0l X-ray 4.77 3 166-302 None
5u8t X-ray 4.9 3 166-302 None
6wgg X-ray 8.1 3 166-319 None
5u8s X-ray 6.1 3 166-302 None
5bk4 X-ray 3.9 3 166-302 None
5bk4 X-ray 3.9 B 166-302 None
6wgi X-ray 10 3 166-319 None
5v8f X-ray 3.9 3 166-302 None
6u0m X-ray 3.9 3 166-302  L-Bb 
6hv9 X-ray 4.98 3 137-302 None


© NPIDB team 2003 - 2021

text