Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P24279
RecName: DNA replication licensing factor MCM3
Begin-End: 25-137
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQDDADERDLLGDDDGDDLEKEKKAA
SSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAYFIPPAEKALTDLADSMD
Structures of the domain P24279 25-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6hv9 X-ray 4.98 3 25-215 None


© NPIDB team 2003 - 2021

text