Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P24279
RecName: DNA replication licensing factor MCM3
Begin-End: 25-159
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQDDADERDLLGDDDGDDLEKEKKAA
SSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAYFIPPAEKALTDLADSMDDVPHPNA
SAVSSRHPWKLSFKG
Structures of the domain P24279 25-159
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 B 25-215 None
6f0l X-ray 4.77 3 25-215 None
5u8t X-ray 4.9 3 25-214 None
6wgg X-ray 8.1 3 25-212 None
5u8s X-ray 6.1 3 25-212 None
5bk4 X-ray 3.9 3 25-215 None
5bk4 X-ray 3.9 B 25-215 None
6wgi X-ray 10 3 25-212 None
5v8f X-ray 3.9 3 25-212 None
6u0m X-ray 3.9 3 25-212 None


© NPIDB team 2003 - 2021

text