Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: P24279
RecName: DNA replication licensing factor MCM3
Begin-End: 346-569
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINI
LMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLA
DRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDV
NRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTH
Structures of the domain P24279 346-569
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 B 346-569  L-Bb L-Mj 
6f0l X-ray 4.77 3 346-569  H-Bb L-Bb L-Mj 
6sko X-ray 3.4 3 346-569 None
5u8t X-ray 4.9 3 346-569 None
6wgg X-ray 8.1 3 346-652 None
5u8s X-ray 6.1 3 346-569 None
5bk4 X-ray 3.9 3 346-569 None
5bk4 X-ray 3.9 B 346-569 None
6wgi X-ray 10 3 346-652  H-Bb 
5v8f X-ray 3.9 3 346-569 None
6u0m X-ray 3.9 3 346-569 None
6hv9 X-ray 4.98 3 346-569 None


© NPIDB team 2003 - 2021

text