Pfam domain
Pfam family: RCC1 (PF00415.20)
Uniprot AC: P25171
RecName: Regulator of chromosome condensation
Begin-End: 363-414
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
DGKLYSWGSGVNNQLGVGDGDDELEPIVVVSKNTQGKHMLLASGGGQHAIFL
Structures of the domain P25171 363-414
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mvd X-ray 2.9 L 363-414 None
3mvd X-ray 2.9 L 196-255  L-Bb 
3mvd X-ray 2.9 K 196-255  L-Bb 
3mvd X-ray 2.9 K 363-414 None


© NPIDB team 2003 - 2021

text