Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: P25205
RecName: DNA replication licensing factor MCM3
Begin-End: 110-245
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFP
SSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKA
KPGDRVQVVGTYRCLP
Structures of the domain P25205 110-245
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 3 155-290 None


© NPIDB team 2003 - 2021

text