Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P25205
RecName: DNA replication licensing factor MCM3
Begin-End: 13-104
Organism: Homo sapiens
Interaction Mode:   

Sequence:
REAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEE
LVAFQRALKDFVASIDATYAKQYEEFYVGLEG
Structures of the domain P25205 13-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 3 58-149 None


© NPIDB team 2003 - 2021

text