Pfam domain
Pfam family: Zn_clus (PF00172.20)
Uniprot AC: P25502
RecName: Proline utilization trans-activator
Begin-End: 32-69
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
VACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKI
Structures of the domain P25502 32-69
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zme X-ray 2.5 D 32-69  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
1zme X-ray 2.5 C 32-69  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text