Pfam domain
Pfam family: SWIB (PF02201.20)
Uniprot AC: P25632
RecName: Chromatin structure-remodeling complex protein RSC6
Begin-End: 60-130
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TNTKTKDHPPNKEMLRIYVYNTTESSPRSDSGTPADSGKTTWTLRIEGKLLHESANGKHP
FSEFLEGVAVD
Structures of the domain P25632 60-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tda X-ray 15 O 230-343 None


© NPIDB team 2003 - 2021

text