Pfam domain
Pfam family: SWIB (PF02201.20)
Uniprot AC: P25632
RecName: Chromatin structure-remodeling complex protein RSC6
Begin-End: 89-171
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DSGTPADSGKTTWTLRIEGKLLHESANGKHPFSEFLEGVAVDFKRLKPLGMGKKRKRDSS
LSLPLNLQQPEYNDQDSTMGDND
Structures of the domain P25632 89-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6v92 X-ray 20 M 230-343 None


© NPIDB team 2003 - 2021

text