Pfam domain
Pfam family: LIM (PF00412.24)
Uniprot AC: P25791
RecName: Rhombotin-2
Begin-End: 30-88
Organism: Homo sapiens
Interaction Mode:   

Sequence:
CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLF
Structures of the domain P25791 30-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ypa X-ray 2.8 C 30-88 None


© NPIDB team 2003 - 2021

text