Pfam domain
Pfam family: BAH (PF01426.20)
Uniprot AC: P26358
RecName: DNA (cytosine-5)-methyltransferase 1
Begin-End: 931-1100
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEP
YRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAV
VDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPP
Structures of the domain P26358 931-1100
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pta X-ray 3.6 A 931-1100 None


© NPIDB team 2003 - 2021

text