Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P27296
RecName: ATP-dependent DNA helicase DinG
Begin-End: 28-120
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RAPQRQMIADVAKTLAGEEGRHLAIEAPTGVGKTLSYLIPGIAIAREEQKTLVVSTANVA
LQDQIYSKDLPLLKKIIPDLKFTAAFGRGRYVC
Structures of the domain P27296 28-120
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fws X-ray 2.5 B 28-120 None
6fws X-ray 2.5 A 28-120 None
6fwr X-ray 2.5 A 28-120 None


© NPIDB team 2003 - 2021

text