Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P27540
RecName: Aryl hydrocarbon receptor nuclear translocator
Begin-End: 90-143
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLR
Structures of the domain P27540 90-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nj8 X-ray 3.3 D 90-143  H-Bb H-Mj 
5nj8 X-ray 3.3 B 90-143  H-Bb H-Mj 
5v0l X-ray 4 A 90-155  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text