Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: P27782
RecName: Lymphoid enhancer-binding factor 1
Begin-End: 297-365
Organism: Mus musculus
Interaction Mode:   

Sequence:
IKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQL
HMQLYPGWS
Structures of the domain P27782 297-365
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2lef NMR A 3-71  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2021

text