Pfam domain
Pfam family: Pou (PF00157.19)
Uniprot AC: P28069
RecName: Pituitary-specific positive transcription factor 1
Begin-End: 127-198
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKL
KAILSKWLEEAE
Structures of the domain P28069 127-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wc9 X-ray 3.15 E 4-75  H-Bb H-Mj L-Bb L-Mj 
5wc9 X-ray 3.15 F 4-75  H-Bb H-Mj L-Bb 
5wc9 X-ray 3.15 A 4-75  H-Bb H-Mj L-Bb L-Mj 
5wc9 X-ray 3.15 B 4-75  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text