Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: P28069
RecName: Pituitary-specific positive transcription factor 1
Begin-End: 217-271
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKR
Structures of the domain P28069 217-271
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wc9 X-ray 3.15 F 75-148  H-Bb H-Mj L-Bb L-Mn 
5wc9 X-ray 3.15 E 76-148  H-Bb H-Mj L-Bb L-Mn 
5wc9 X-ray 3.15 A 79-148  H-Bb H-Mj L-Bb L-Mn 
5wc9 X-ray 3.15 B 76-148  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text