Pfam domain
Pfam family: XPG_I (PF00867.20)
Uniprot AC: P28715
RecName: DNA repair protein complementing XP-G cells
Begin-End: 780-861
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GIPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVD
FHNQLGLDRNKLINLAYLLGSD
Structures of the domain P28715 780-861
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tux X-ray 3.1 B 780-861 None
6tux X-ray 3.1 A 780-861 None
6tuw X-ray 3.5 A 780-861 None


© NPIDB team 2003 - 2021

text