Pfam domain
Pfam family: TFIIB (PF00382.21)
Uniprot AC: P29055
RecName: Transcription initiation factor IIB
Begin-End: 122-213
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCR
RAEVARTFKEIQSLIHVKTKEFGKTLNIMKNI
Structures of the domain P29055 122-213
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4bbs X-ray 3.6 M 122-213 None
5fmf X-ray 6 P 122-221 None
4v1o X-ray 9.7 M 122-213 None
5fyw X-ray 4.35 M 57-213  H-Bb 
4v1n X-ray 7.8 M 122-213 None
6gyk X-ray 5.1 M 122-213 None
5oqj X-ray 4.7 M 122-213 None
5fz5 X-ray 8.8 M 57-213  H-Bb 
5oqm X-ray 5.8 M 143-213 None
6gym X-ray 6.7 M 122-213  L-Bb 
6gyl X-ray 4.8 M 122-213  L-Bb 
5sva X-ray 15.3 c 100-191 None


© NPIDB team 2003 - 2021

text