Pfam domain
Pfam family: TF_Zn_Ribbon (PF08271.14)
Uniprot AC: P29055
RecName: Transcription initiation factor IIB
Begin-End: 22-58
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVD
Structures of the domain P29055 22-58
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fyw X-ray 4.35 M 22-129 None
5fz5 X-ray 8.8 M 22-129 None


© NPIDB team 2003 - 2021

text