Pfam domain
Pfam family: TF_Zn_Ribbon (PF08271.14)
Uniprot AC: P29055
RecName: Transcription initiation factor IIB
Begin-End: 22-66
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTF
Structures of the domain P29055 22-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4bbs X-ray 3.6 M 22-66 None
5fmf X-ray 6 P 22-66 None
4v1o X-ray 9.7 M 22-66 None
4v1n X-ray 7.8 M 22-66 None
6gyk X-ray 5.1 M 22-66 None
5oqj X-ray 4.7 M 22-66 None
5oqm X-ray 5.8 M 19-63 None
6gym X-ray 6.7 M 22-66 None
6gyl X-ray 4.8 M 22-66 None
5sva X-ray 15.3 c 3-47 None


© NPIDB team 2003 - 2021

text