Pfam domain
Pfam family: TFIIB (PF00382.21)
Uniprot AC: P29055
RecName: Transcription initiation factor IIB
Begin-End: 233-319
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
AQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIP
ITAAKVGQTLQVTEGTIKSGYKILYEH
Structures of the domain P29055 233-319
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 P 223-319  H-Bb L-Mj 
4v1o X-ray 9.7 M 211-319  H-Bb H-Mj L-Bb L-Mj 
5fyw X-ray 4.35 M 215-319  L-Bb 
4v1n X-ray 7.8 M 211-319  H-Bb H-Mj L-Bb L-Mj 
6gyk X-ray 5.1 M 216-319  L-Bb L-Mj 
5oqj X-ray 4.7 M 216-319 None
5fz5 X-ray 8.8 M 215-319  L-Bb 
5oqm X-ray 5.8 M 216-319 None
6gym X-ray 6.7 M 216-319  L-Bb 
6gyl X-ray 4.8 M 216-319  L-Bb 


© NPIDB team 2003 - 2021

text