Pfam domain
Pfam family: BRF1 (PF07741.15)
Uniprot AC: P29056
RecName: Transcription factor IIIB 70 kDa subunit
Begin-End: 463-512
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQEADIATG
Structures of the domain P29056 463-512
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 Z 463-512 None
6f44 X-ray 4.2 V 463-510 None
6f41 X-ray 4.3 V 463-510 None
6f40 X-ray 3.7 V 463-510 None


© NPIDB team 2003 - 2021

text