Pfam domain
Pfam family: TFA2_Winged_2 (PF18121.3)
Uniprot AC: P29084
RecName: Transcription initiation factor IIE subunit beta
Begin-End: 146-204
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFN
Structures of the domain P29084 146-204
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iyc X-ray 3.9 R 146-204 None
6o9l X-ray 7.2 R 146-204 None
5iy9 X-ray 6.3 R 146-204 None
5iyb X-ray 3.9 R 146-204 None
5iy6 X-ray 7.2 R 146-204 None
5iya X-ray 5.4 R 146-204 None
5iy8 X-ray 7.9 R 146-204 None
5iyd X-ray 3.9 R 146-204 None
5iy7 X-ray 8.6 R 146-204 None


© NPIDB team 2003 - 2021

text