Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: P29469
RecName: DNA replication licensing factor MCM2
Begin-End: 311-434
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISFCTNCKSK
GPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIY
KNNY
Structures of the domain P29469 311-434
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6hv9 X-ray 4.98 2 295-434 None


© NPIDB team 2003 - 2021

text