Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: P29469
RecName: DNA replication licensing factor MCM2
Begin-End: 480-703
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINV
LLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLA
DKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNS
TLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSH
Structures of the domain P29469 480-703
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 A 480-703 None
6f0l X-ray 4.77 2 480-703  L-Bb 
6sko X-ray 3.4 2 480-703 None
5u8t X-ray 4.9 2 480-703 None
6wgg X-ray 8.1 2 480-703 None
5u8s X-ray 6.1 2 480-703 None
5bk4 X-ray 3.9 A 480-703 None
5bk4 X-ray 3.9 2 480-703 None
6wgi X-ray 10 2 480-703 None
5v8f X-ray 3.9 2 480-703 None
6u0m X-ray 3.9 2 480-703 None
6hv9 X-ray 4.98 2 480-703 None


© NPIDB team 2003 - 2021

text