Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: P29496
RecName: Minichromosome maintenance protein 5
Begin-End: 146-302
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTV
SLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELV
PVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYN
Structures of the domain P29496 146-302
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 5 146-302 None
6f0l X-ray 4.77 D 146-302  L-Bb 
5u8t X-ray 4.9 5 146-302 None
6wgg X-ray 8.1 5 146-324 None
5u8s X-ray 6.1 5 146-302 None
5bk4 X-ray 3.9 5 146-302 None
5bk4 X-ray 3.9 D 146-302 None
6wgi X-ray 10 5 146-324 None
5v8f X-ray 3.9 5 146-302 None
6u0m X-ray 3.9 5 146-302 None


© NPIDB team 2003 - 2021

text