Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: P29496
RecName: Minichromosome maintenance protein 5
Begin-End: 152-302
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTVSLPRSC
LSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMP
RNLTMTCDRYLTNKVIPGTRVTIVGIYSIYN
Structures of the domain P29496 152-302
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6hv9 X-ray 4.98 5 139-302 None


© NPIDB team 2003 - 2021

text