Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P29496
RecName: Minichromosome maintenance protein 5
Begin-End: 28-103
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IKSFKNFILEFRLDSQFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDII
PLFETAITQVAKRISI
Structures of the domain P29496 28-103
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u8t X-ray 4.9 5 28-157 None
5u8s X-ray 6.1 5 28-161 None
6u0m X-ray 3.9 5 28-161 None
6hv9 X-ray 4.98 5 28-165 None


© NPIDB team 2003 - 2021

text