Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P29496
RecName: Minichromosome maintenance protein 5
Begin-End: 28-110
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IKSFKNFILEFRLDSQFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDII
PLFETAITQVAKRISILSRAQSA
Structures of the domain P29496 28-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 D 29-138 None
6f0l X-ray 4.77 5 29-138 None
6wgg X-ray 8.1 5 29-138 None
5bk4 X-ray 3.9 D 29-138 None
5bk4 X-ray 3.9 5 29-138 None
6wgi X-ray 10 5 29-138 None
5v8f X-ray 3.9 5 29-138 None


© NPIDB team 2003 - 2021

text