Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: P29496
RecName: Minichromosome maintenance protein 5
Begin-End: 353-553
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINV
LLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLA
DGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDD
LKSPGDNIDFQTTILSRFDMI
Structures of the domain P29496 353-553
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wgg X-ray 8.1 5 353-600 None
6wgi X-ray 10 5 353-600 None


© NPIDB team 2003 - 2021

text