Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: P29496
RecName: Minichromosome maintenance protein 5
Begin-End: 353-576
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINV
LLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLA
DGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDD
LKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIH
Structures of the domain P29496 353-576
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 D 353-576 None
6f0l X-ray 4.77 5 353-576 None
6sko X-ray 3.4 5 353-546 None
5u8t X-ray 4.9 5 353-576 None
5u8s X-ray 6.1 5 353-576 None
5bk4 X-ray 3.9 D 353-576 None
5bk4 X-ray 3.9 5 353-576 None
6u0m X-ray 3.9 5 353-576 None
6hv9 X-ray 4.98 5 353-576 None


© NPIDB team 2003 - 2021

text