Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: P29496
RecName: Minichromosome maintenance protein 5
Begin-End: 365-576
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQ
LLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDK
MRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQT
TILSRFDMIFIVKDDHNEERDISIANHVINIH
Structures of the domain P29496 365-576
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v8f X-ray 3.9 5 335-576 None


© NPIDB team 2003 - 2021

text